{"product_id":"proteintech-24645-1-ap","title":"Proteintech, 24645-1-AP, TMEM111 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM111 (24645-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM111 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n24645-1-AP targets TMEM111 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  HuH-7 cells,  MDA-MB-453s cells,  NIH\/3T3 cells,  mouse brain tissue,  mouse stomach tissue,  mouse testis tissue,  rat brain tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM111,also names as EMC3, is part of the endoplasmic reticulum-associated secretory pathway (PMID: 19797678). TMEM111 was required for murine pulmonary surfactant synthesis and lung function at birth (PMID: 29083321). It can be detect a band of 30 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18236 Product name: Recombinant human TMEM111 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 139-261 aa of BC022807 Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF Predict reactive species\nFull Name: transmembrane protein 111\nCalculated Molecular Weight: 261 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC022807\nGene Symbol: TMEM111\nGene ID (NCBI): 55831\nRRID: AB_3085744\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P0I2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887830028457,"sku":"24645-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24645-1-ap","provider":"Iright","version":"1.0","type":"link"}