{"product_id":"proteintech-24687-1-ap","title":"Proteintech, 24687-1-AP, AMMECR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMMECR1 (24687-1-AP) by Proteintech is a Polyclonal antibody targeting AMMECR1 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n24687-1-AP targets AMMECR1 in WB, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  mouse liver tissue,  mouse uterus tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAMMECR1 also named as AMME syndrome candidate gene 1 protein is a 333 amino acid protein, which contains 1 AMMECER1 domain. Containing a glycine-rich N terminus, the AMMECR1 protein exhibits putative nuclear localization and a substantial level of instability, suggesting it plays a role in regulation. The deletion of AMMECR1 gene may be involved in glomerulonephritis, sensorineural hearing loss, mental retardation, midface hypoplasia and elliptocytosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16977 Product name: Recombinant human AMMECR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-296 aa of BC060813 Sequence: MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTLSPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS Predict reactive species\nFull Name: Alport syndrome, mental retardation, midface hypoplasia and elliptocytosis chromosomal region gene 1\nCalculated Molecular Weight: 330 aa, 35 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC060813\nGene Symbol: AMMECR1\nGene ID (NCBI): 9949\nRRID: AB_2879671\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y4X0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869809201321,"sku":"24687-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24687-1-ap","provider":"Iright","version":"1.0","type":"link"}