{"product_id":"proteintech-24691-1-ap","title":"Proteintech, 24691-1-AP, EYA4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EYA4 (24691-1-AP) by Proteintech is a Polyclonal antibody targeting EYA4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human,   mouse, rat samples\n24691-1-AP targets EYA4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human,   mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse heart tissue,  mouse liver tissue,  mouse skeletal muscle tissue,  L02 cells,  rat liver tissue\nPositive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEYA4 (Eyes absent homolog 4) participates directly in the modulation of cellular signaling through its phosphatase activity and plays a role in the embryonic and post-natal development of the mature organs of CORTI. This protein may be involved in the development of the eye. It has 5 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20466 Product name: Recombinant human EYA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-201 aa of BC041063 Sequence: STPAAQTMSAYAGQTQYSGMQQPAVYTAYSQTGQPYSLPTYDLGVMLPAIKTESGLSQTQSPLQSGCLSYSP Predict reactive species\nFull Name: eyes absent homolog 4 (Drosophila)\nCalculated Molecular Weight: 639 aa, 70 kDa\nObserved Molecular Weight: 67-70 kDa\nGenBank Accession Number: BC041063\nGene Symbol: EYA4\nGene ID (NCBI): 2070\nRRID: AB_2879675\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95677\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869460156585,"sku":"24691-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24691-1-ap","provider":"Iright","version":"1.0","type":"link"}