{"product_id":"proteintech-24701-1-ap","title":"Proteintech, 24701-1-AP, POLR3G Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POLR3G (24701-1-AP) by Proteintech is a Polyclonal antibody targeting POLR3G in WB, IP, ELISA applications with reactivity to human samples\n24701-1-AP targets POLR3G in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, K-562 cells\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPOLR3G also named as RNA polymerase III subunit C7 is a 223 amino acid protein, which belongs to eukaryotic RPC7 RNA polymerase subunit family. The molecular weight of POLR3G is 26 kDa. POLR3G localizes in the nucleus and is a component of the RNA polymerase III complex, which may be involved either in the recruitment and stablization of the subcomplex within RNA polymerase III, or in stimulating catalytic functions of other subunits during initiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19872 Product name: Recombinant human POLR3G protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-223 aa of BC141649 Sequence: MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY Predict reactive species\nFull Name: polymerase (RNA) III (DNA directed) polypeptide G (32kD)\nCalculated Molecular Weight: 223 aa, 26 kDa\nObserved Molecular Weight: 26-30 kDa\nGenBank Accession Number: BC141649\nGene Symbol: POLR3G\nGene ID (NCBI): 10622\nRRID: AB_2879681\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15318\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869575368873,"sku":"24701-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24701-1-ap","provider":"Iright","version":"1.0","type":"link"}