{"product_id":"proteintech-24723-1-ap","title":"Proteintech, 24723-1-AP, IL-36 Gamma\/IL-1F9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-36 Gamma\/IL-1F9 (24723-1-AP) by Proteintech is a Polyclonal antibody targeting IL-36 Gamma\/IL-1F9 in IHC, ELISA applications with reactivity to human samples\n24723-1-AP targets IL-36 Gamma\/IL-1F9 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon cancer tissue, human pancreas tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-36 Gamma is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2\/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5\/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21489 Product name: Recombinant human IL-1F9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-169 aa of BC098337 Sequence: MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND Predict reactive species\nFull Name: interleukin 1 family, member 9\nCalculated Molecular Weight: 169 aa, 19 kDa\nGenBank Accession Number: BC098337\nGene Symbol: IL-36 gamma\/IL-1F9\nGene ID (NCBI): 56300\nRRID: AB_2879690\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZH8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869551317161,"sku":"24723-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24723-1-ap","provider":"Iright","version":"1.0","type":"link"}