{"product_id":"proteintech-24782-1-ap","title":"Proteintech, 24782-1-AP, MOSC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MOSC2 (24782-1-AP) by Proteintech is a Polyclonal antibody targeting MOSC2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n24782-1-AP targets MOSC2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, HEK-293 cells,  mouse liver tissue,  rat liver tissue,  rat kidney tissue\nPositive IHC detected in: human liver cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMOSC domain-containing protein 2 (also known as MOSC2), also known as MARC2, is a component of prodrug-converting system, reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability. Also, MOSC2 may be involved in mitochondrial N(omega)-hydroxy-L-arginine (NOHA) reduction, regulating endogenou1s nitric oxide levels and biosynthesis. The reductase activity is regulated under adipogenic conditions, and down-regulation of the terminal component MOSC2 resulted in decreased lipid synthesis, suggesting a possible physiological role of this enzyme system and its component MOSC2 in lipogenesis(PMID: 22203676).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20694 Product name: Recombinant human MOSC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-229 aa of BC011973 Sequence: YENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDASLVDLNTRMEK Predict reactive species\nFull Name: MOCO sulphurase C-terminal domain containing 2\nCalculated Molecular Weight: 335 aa, 38 kDa\nObserved Molecular Weight: 35-38 kDa\nGenBank Accession Number: BC011973\nGene Symbol: MOSC2\nGene ID (NCBI): 54996\nRRID: AB_2879719\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969Z3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869560787113,"sku":"24782-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24782-1-ap","provider":"Iright","version":"1.0","type":"link"}