{"product_id":"proteintech-24783-1-ap","title":"Proteintech, 24783-1-AP, ANKS1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANKS1B (24783-1-AP) by Proteintech is a Polyclonal antibody targeting ANKS1B in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n24783-1-AP targets ANKS1B in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells,  HeLa cells,  mouse testis tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANKS1B also named as AIDA or cajalin 2 is a amino acid protein, which contains 7 ANK repeats, 1 PID domain and 2 SAM domains. ANKS1B localizes in cytoplasm and is highly expressed in brain and testis. ANKS1B exists as many alternatively spliced isoforms. It interacts with AbPP to play a role in brain development. AIDA-1 also interacts with coilin in Cajal bodies to regulate pre-mRNA splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20454 Product name: Recombinant human ANKS1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 446-510 aa of BC026313 Sequence: GHSSTLPESFENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF Predict reactive species\nFull Name: ankyrin repeat and sterile alpha motif domain containing 1B\nCalculated Molecular Weight: 1248 aa, 138 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC026313\nGene Symbol: ANKS1B\nGene ID (NCBI): 56899\nRRID: AB_2879720\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z6G8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869636055209,"sku":"24783-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24783-1-ap","provider":"Iright","version":"1.0","type":"link"}