{"product_id":"proteintech-24786-1-ap","title":"Proteintech, 24786-1-AP, TMEM35 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM35 (24786-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM35 in WB, ELISA applications with reactivity to human, mouse samples\n24786-1-AP targets TMEM35 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM35 is a 167-amino acid peptide with a putative NH2 terminal signal peptide, three hydrophobic transmembrane domains, and a nerve growth factor binding domain.TMEM35is 18kDa and has been shown to localize to membrane-bound structures within cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20589 Product name: Recombinant human TMEM35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-167 aa of BC078658 Sequence: LTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS Predict reactive species\nFull Name: transmembrane protein 35\nCalculated Molecular Weight: 167 aa, 18 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC078658\nGene Symbol: TMEM35\nGene ID (NCBI): 59353\nRRID: AB_2879723\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53FP2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869617574057,"sku":"24786-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24786-1-ap","provider":"Iright","version":"1.0","type":"link"}