{"product_id":"proteintech-24835-1-ap","title":"Proteintech, 24835-1-AP, FOXD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FOXD4 (24835-1-AP) by Proteintech is a Polyclonal antibody targeting FOXD4 in WB, ELISA applications with reactivity to human,  mouse,  rat samples\n24835-1-AP targets FOXD4 in WB, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells,  Jurkat cells,  RAW 264.7 cells,  U-937 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nForkhead box protein D4(FOXD4)also named as FKHL9 or Myeloid factor alpha is a 439 amino acid protein, which contains one fork head DNA-binding domain. FOXD4L6 localizes in the nucleus. FOXD4 as an embryonic transcriptional regulator involves in leukemogenesis. The molecular weight of FOXD4L6 is 47kDa, but our experiment always detected a 60-70kDa protein by western blot.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19226 Product name: Recombinant human FOXD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 361-439 aa of BC136570 Sequence: ILQQQQRHQEEDCANGCAPTKGAVLGGHLSAASALLRYQAVAEGSGLTSLAAPLGGEGTSPVFLVSPTPSSLAESAGPS Predict reactive species\nFull Name: forkhead box D4\nCalculated Molecular Weight: 439 aa, 47 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC136570\nGene Symbol: FOXD4\nGene ID (NCBI): 2298\nRRID: AB_2879750\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12950\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887642333353,"sku":"24835-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24835-1-ap","provider":"Iright","version":"1.0","type":"link"}