{"product_id":"proteintech-24867-1-ap","title":"Proteintech, 24867-1-AP, C22orf41 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C22orf41 (24867-1-AP) by Proteintech is a Polyclonal antibody targeting C22orf41 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n24867-1-AP targets C22orf41 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse testis tissue, rat testis tissue,  human small intestine tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC22orf41 is also named as SYCE3 and THEG2. C22orf41 is major component of the transverse central element of synaptonemal complexes (SCS). It formed between homologous chromosomes during meiotic prophase. SYCE3 is a small protein of 88 amino acids that is essential for SC assembly, meiotic division, and fertility (PMID:21637789).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21756 Product name: Recombinant human C22orf41 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC127859 Sequence: MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRL Predict reactive species\nFull Name: chromosome 22 open reading frame 41\nCalculated Molecular Weight: 88 aa, 11 kDa\nGenBank Accession Number: BC127859\nGene Symbol: C22orf41\nGene ID (NCBI): 644186\nRRID: AB_2879765\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A1L190\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869519958185,"sku":"24867-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24867-1-ap","provider":"Iright","version":"1.0","type":"link"}