{"product_id":"proteintech-24905-1-ap","title":"Proteintech, 24905-1-AP, GRAMD1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRAMD1B (24905-1-AP) by Proteintech is a Polyclonal antibody targeting GRAMD1B in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n24905-1-AP targets GRAMD1B in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\nPositive FC (Intra) detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRAMD1B, also named as KIAA1201, contains a transmembrane region and two domains of known function; the GRAM domain and a VASt domain. It is predicted to localize in the nucleus, supported by several nuclear transport signals and nuclearly associated motifs. This highly conserved gene is found in a variety of vertebrates and invertebrates, however, it is not found in bacteria or fungi. There're some isoforms with MW 50 kDa and 81-87 kDa. With phosphor modification, it's about 90-110 kDa in WB detection.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20670 Product name: Recombinant human GRAMD1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 235-504 aa of BC107480 Sequence: YVPPDDDFNTMGYCEEIPVEENEVNDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLPLEEEALEGDGSLEKELAIDNIMGEKIEMIAPVNSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRY Predict reactive species\nFull Name: GRAM domain containing 1B\nCalculated Molecular Weight: 738 aa, 85 kDa\nObserved Molecular Weight: 85 kDa\nGenBank Accession Number: BC107480\nGene Symbol: GRAMD1B\nGene ID (NCBI): 57476\nRRID: AB_2879791\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q3KR37\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868933935273,"sku":"24905-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24905-1-ap","provider":"Iright","version":"1.0","type":"link"}