{"product_id":"proteintech-24931-1-ap","title":"Proteintech, 24931-1-AP, SRBD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRBD1 (24931-1-AP) by Proteintech is a Polyclonal antibody targeting SRBD1 in WB, IP, IHC, ELISA applications with reactivity to human,  mouse samples\n24931-1-AP targets SRBD1 in WB, IP, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS1 RNA-binding domain-containing protein 1 (SRBD1) is a 995 amino acid protein, which contains one S1 motif domain. SRBD1 is a susceptibility gene for normal tension glaucoma (NTG) and may be involved in cell growth inhibition and apoptosis. Two isoforms of SRBD1 exist due to alternative splicing events, and the gene which encodes SRBD1 maps to human chromosome 2p21.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21661 Product name: Recombinant human SRBD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 657-995 aa of BC032538 Sequence: SIARRVQDPLAELVKIEPKHIGVGMYQHDVSQTLLKATLDSVVEECVSFVGVDINICSEVLLRHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFIRINQDYIRTFCSQQTETSGQIQGVAVTSSADVEVTNEKQGKKKSKTAVNVLLKPNPLDQTCIHPESYDIAMRFLSSIGGTLYEVGKPEMQQKINSFLEKEGMEKIAERLQTTVHTLQVIIDGLSQPESFDFRTDFDKPDFKRSIVCLEDLQIGTVLTGKVENATLFGIFVDIGVGKSGLIPIRNVTEAKLSKTKKRRSLGLGPGERVEVQVLNIDIPRSRITLDLIRVL Predict reactive species\nFull Name: S1 RNA binding domain 1\nCalculated Molecular Weight: 995 aa, 112 kDa\nObserved Molecular Weight: 100-120 kDa\nGenBank Accession Number: BC032538\nGene Symbol: SRBD1\nGene ID (NCBI): 55133\nRRID: AB_2879805\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N5C6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887816200361,"sku":"24931-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24931-1-ap","provider":"Iright","version":"1.0","type":"link"}