{"product_id":"proteintech-24946-1-ap","title":"Proteintech, 24946-1-AP, PRPF38A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRPF38A (24946-1-AP) by Proteintech is a Polyclonal antibody targeting PRPF38A in WB, IF\/ICC, ELISA applications with reactivity to human samples\n24946-1-AP targets PRPF38A in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells,  HepG2 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRPF38A was identified as an essential splicing factor in yeast and was found to be important for the progression of the splicing process to the first splicing step in this organism. PRPF38A is one of nine splicing factors that are specifically incorporated during the formation of the pre-catalytic spliceosomal B complex (B-specific proteins) and that are released again during spliceosome activation3 (PMID: 35869234). PRPF38A knockdown led to widespread intronic retention and altered splicing of transcripts of genes implicated in protein metabolism, mitosis, proteasome function and apoptosis (PMID: 28878028).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20980 Product name: Recombinant human PRPF38A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 188-312 aa of BC000777 Sequence: MDDVESSEEEEEEDEKLERVPSPDHRRRSYRDLDKPRRSPTLRYRRSRSRSPRRRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRGNE Predict reactive species\nFull Name: PRP38 pre-mRNA processing factor 38 (yeast) domain containing A\nCalculated Molecular Weight: 312 aa, 37 kDa\nObserved Molecular Weight: 37-40 kDa\nGenBank Accession Number: BC000777\nGene Symbol: PRPF38A\nGene ID (NCBI): 84950\nRRID: AB_2879814\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NAV1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887774617769,"sku":"24946-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24946-1-ap","provider":"Iright","version":"1.0","type":"link"}