{"product_id":"proteintech-24956-1-ap","title":"Proteintech, 24956-1-AP, LCE1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LCE1A (24956-1-AP) by Proteintech is a Polyclonal antibody targeting LCE1A in IHC, ELISA applications with reactivity to human samples\n24956-1-AP targets LCE1A in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nlate cornified envelope 1A (LCE1A), also named as LEP1, is a 110 amino acid protein, which belongs to the LCE family. LCE1A is a Precursor of the cornified envelope of the stratum corneum. LCE1A is detected in dult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21047 Product name: Recombinant human LCE1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-41 aa of BC153155 Sequence: MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVS Predict reactive species\nFull Name: late cornified envelope 1A\nCalculated Molecular Weight: 110 aa, 11 kDa\nGenBank Accession Number: BC153155\nGene Symbol: LCE1A\nGene ID (NCBI): 353131\nRRID: AB_2879820\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5T7P2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887701872809,"sku":"24956-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24956-1-ap","provider":"Iright","version":"1.0","type":"link"}