{"product_id":"proteintech-24959-1-ap","title":"Proteintech, 24959-1-AP, BTNL8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BTNL8 (24959-1-AP) by Proteintech is a Polyclonal antibody targeting BTNL8 in WB, IHC, ELISA applications with reactivity to human samples\n24959-1-AP targets BTNL8 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21203 Product name: Recombinant human BTNL8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-147 aa of BC119696 Sequence: CSMRHAHLSREVESRVQIGDTFFKPISWHLATKVLGILCCGLFFGIVGLKIFFSKFQW Predict reactive species\nFull Name: butyrophilin-like 8\nCalculated Molecular Weight: 500 aa, 57 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC119696\nGene Symbol: BTNL8\nGene ID (NCBI): 79908\nRRID: AB_2879822\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UX41\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885330026665,"sku":"24959-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-24959-1-ap","provider":"Iright","version":"1.0","type":"link"}