{"product_id":"proteintech-25061-1-ap","title":"Proteintech, 25061-1-AP, RNF135 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RNF135 (25061-1-AP) by Proteintech is a Polyclonal antibody targeting RNF135 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n25061-1-AP targets RNF135 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, U-251 cells,  U-87 MG cells\nPositive IHC detected in: human kidney tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-12 cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRing finger protein 135 (RNF135), located on chromosome 17q11.2, is a RING finger domain-containing E3 ubiquitin ligase that was identified as a bio-marker and therapy target of glioblastoma (PMID: 26856755).  RNF135 facilitates RIG-I C-terminal ubiquitination to up-regulate RIG-I-mediated IFN signaling and suppress viral replication. This antibody can detect a band at 48 kDa as predicted.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18821 Product name: Recombinant human RNF135 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-210 aa of BC005084 Sequence: MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT Predict reactive species\nFull Name: ring finger protein 135\nCalculated Molecular Weight: 432 aa, 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC005084\nGene Symbol: RNF135\nGene ID (NCBI): 84282\nRRID: AB_2879879\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IUD6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869427257513,"sku":"25061-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25061-1-ap","provider":"Iright","version":"1.0","type":"link"}