{"product_id":"proteintech-25085-1-ap","title":"Proteintech, 25085-1-AP, NPSR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NPSR1 (25085-1-AP) by Proteintech is a Polyclonal antibody targeting NPSR1 in IHC, ELISA applications with reactivity to human samples\n25085-1-AP targets NPSR1 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human colon cancer tissue, human cervical cancer tissue,  human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuropeptide S receptor 1 (NPSR1), previously known as GPRA and GPR154, is a G protein-coupled receptor (GPCR) that plays a significant role in various physiological processes. NPSR1 is primarily expressed in the bronchus, brain, and immune cells. It is also found in specific peripheral cell types such as monocytes\/macrophages and neuroendocrine cells of the gut (PMID: 30711025).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18785 Product name: Recombinant human NPSR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC132693 Sequence: MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQ Predict reactive species\nFull Name: neuropeptide S receptor 1\nCalculated Molecular Weight: 371 aa, 43 kDa\nGenBank Accession Number: BC132693\nGene Symbol: NPSR1\nGene ID (NCBI): 387129\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6W5P4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887741456553,"sku":"25085-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25085-1-ap","provider":"Iright","version":"1.0","type":"link"}