{"product_id":"proteintech-25097-1-ap","title":"Proteintech, 25097-1-AP, ODF3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ODF3 (25097-1-AP) by Proteintech is a Polyclonal antibody targeting ODF3 in WB, IHC, ELISA applications with reactivity to human,  rat samples\n25097-1-AP targets ODF3 in WB, IHC, ELISA applications and shows reactivity with human,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18734 Product name: Recombinant human ODF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-102 aa of BC126248 Sequence: LYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLLAENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTMLTPG Predict reactive species\nFull Name: outer dense fiber of sperm tails 3\nCalculated Molecular Weight: 254 aa, 28 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC126248\nGene Symbol: ODF3\nGene ID (NCBI): 113746\nRRID: AB_2879894\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96PU9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887745257641,"sku":"25097-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25097-1-ap","provider":"Iright","version":"1.0","type":"link"}