{"product_id":"proteintech-25098-1-ap","title":"Proteintech, 25098-1-AP, JMY Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe JMY (25098-1-AP) by Proteintech is a Polyclonal antibody targeting JMY in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n25098-1-AP targets JMY in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HeLa cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human colon cancer tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJunction mediating and regulatory protein(JMY) is a 988 amino acid protein, which contains one WH2 domain and belongs to the JMY family. IIn nucleus, JMY acts both a nuclear p53\/TP53-cofactor and a cytoplasmic regulator of actin dynamics in response to cellular stress. In cytoplasm, JMY acts as a nucleation-promoting factor for both branched and unbranched actin filaments. Due to alternative splicing, several isoforms of JMY are produced, and these various isoforms have different influencing affects on p53 activation, with some isoforms markedly enhancing p53 responses compared to the other splicing variants.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18735 Product name: Recombinant human JMY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 712-988 aa of BC130624 Sequence: LRLAHARRKGAASPVLQEDHCDSLPSVLQVEEKTEEVGEGRVKRGPSQTTEPQSLVQLEDTSLTQLEATSLPLSGVTSELPPTISLPLLNNNLEPCSVTINPLPSPLPPTPPPLPVAKDSGPETLEKDLPRKEGNEKRIPKSASAPSAHLFDSSQLVSARKKLRKTAEGLQRRRVSSPMDEVLASLKRGSFHLKKVEQRTLPPFPDEDDSNNILAQIRKGVKLKKVQKDVLRESFTLLPDTDPLTRSIHEALRRIKEASPESEDEEEALPCTDWEN Predict reactive species\nFull Name: junction mediating and regulatory protein, p53 cofactor\nCalculated Molecular Weight: 988 aa, 111 kDa\nObserved Molecular Weight: 111 kDa\nGenBank Accession Number: BC130624\nGene Symbol: JMY\nGene ID (NCBI): 133746\nRRID: AB_2879895\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8N9B5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869552693417,"sku":"25098-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25098-1-ap","provider":"Iright","version":"1.0","type":"link"}