{"product_id":"proteintech-25099-1-ap","title":"Proteintech, 25099-1-AP, ATXN3L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATXN3L (25099-1-AP) by Proteintech is a Polyclonal antibody targeting ATXN3L in WB, ELISA applications with reactivity to human samples\n25099-1-AP targets ATXN3L in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATXN3L also named as ataxin 3 like or MJDL is a 355 amino acid protein, which contains one Josephin domain and two UIM repeats. ATXN3L localizes in nucleus and may cleave poly ubiquitin chain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18740 Product name: Recombinant human ATXN3L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-341 aa of BC137186 Sequence: CVTPASEQPKKIKEDYFEKHQQEQKQQQQQSDLPGHSSYLHERPTTSSRAIESDLSDDISEDTVQAAVDTI Predict reactive species\nFull Name: ataxin 3-like\nCalculated Molecular Weight: 355 aa, 41 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC137186\nGene Symbol: ATXN3L\nGene ID (NCBI): 92552\nRRID: AB_2879896\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H3M9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885143216297,"sku":"25099-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25099-1-ap","provider":"Iright","version":"1.0","type":"link"}