{"product_id":"proteintech-25104-1-ap","title":"Proteintech, 25104-1-AP, MYO16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYO16 (25104-1-AP) by Proteintech is a Polyclonal antibody targeting MYO16 in WB, ELISA applications with reactivity to human,  rat samples\n25104-1-AP targets MYO16 in WB, ELISA applications and shows reactivity with human,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYO16, also named as KIAA0865, MYO16B, is actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. MYO16 may be involved in targeting of the catalytic subunit of protein phosphatase 1 during brain development. The antibody can recognize isoform1, isoform2 and isoform3 of MYO16.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18798 Product name: Recombinant human MYO16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 226-410 aa of BC146791 Sequence: LHMACASGYKEVVSLILEHGGDLNIVDDQYWTPLHLAAKYGQTNLVKLLLMHQANPHLVNCNEEKASDIAASEFIEEMLLKAEIAWEEKMKEPLSASTLAQEEPYEEIIHDLPVLSSKLSPLVLPIAKQDSLLEKDIMFKDATKGLCKQQSQDSIPENPMMSGSTKPEQVKLMPPAPNDDLATLS Predict reactive species\nFull Name: myosin XVI\nCalculated Molecular Weight: 1858 aa, 206 kDa\nObserved Molecular Weight: 200-240 kDa\nGenBank Accession Number: BC146791\nGene Symbol: MYO16\nGene ID (NCBI): 23026\nRRID: AB_2879898\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6X6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869563670697,"sku":"25104-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25104-1-ap","provider":"Iright","version":"1.0","type":"link"}