{"product_id":"proteintech-25114-1-ap","title":"Proteintech, 25114-1-AP, POU3F4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POU3F4 (25114-1-AP) by Proteintech is a Polyclonal antibody targeting POU3F4 in WB, ELISA applications with reactivity to human,   mouse samples\n25114-1-AP targets POU3F4 in WB, IF, ELISA applications and shows reactivity with human,   mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOTF9 also named as BRN4 and POU3F4, belongs to the POU transcription factor family and Class-3 subfamily. OTF9 is a transcription factor which exerts its primary action widely during early neural development and in a very limited set of neurons in the mature brain. Mutation of OTF9 will cause of X-linked deafness type 3 (DFN3).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18925 Product name: Recombinant human POU3F4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-181 aa of BC146551 Sequence: SILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQ Predict reactive species\nFull Name: POU class 3 homeobox 4\nCalculated Molecular Weight: 361 aa, 39 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC146551\nGene Symbol: POU3F4\nGene ID (NCBI): 5456\nRRID: AB_2879903\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49335\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869488795817,"sku":"25114-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25114-1-ap","provider":"Iright","version":"1.0","type":"link"}