{"product_id":"proteintech-25117-1-ap","title":"Proteintech, 25117-1-AP, SHOX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SHOX (25117-1-AP) by Proteintech is a Polyclonal antibody targeting SHOX in WB, ELISA applications with reactivity to human,  mouse samples\n25117-1-AP targets SHOX in WB, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nShort stature homeobox protein (SHOX), also named as GCFX, is a 292 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the paired homeobox family. SHOX. SHOX controls fundamental aspects of growth and development. SHOX undergoes splicing resulting in two isoforms, SHOXA and SHOXB. SHOXA is a 32 kDa protein and is expressed in skeletal muscle, placental, pancreas, heart and bone marrow fibroblast and, to a lesser extent, in kidney and lung. SHOXB is 25 kDa protein and is highly expressed in osteogenic cells, but not expressed in brain, kidney, liver or lung.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18930 Product name: Recombinant human SHOX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-110 aa of BC148783 Sequence: KDGNGGGGGGGGKKDSITYREVLESGLARSRELGTSDSSLQDITEGGGHCPVHLFKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVKSEDED Predict reactive species\nFull Name: short stature homeobox\nCalculated Molecular Weight: 292 aa, 32 kDa\nObserved Molecular Weight: 25-32 kDa\nGenBank Accession Number: BC148783\nGene Symbol: SHOX\nGene ID (NCBI): 6473\nRRID: AB_2879905\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15266\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887801389225,"sku":"25117-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25117-1-ap","provider":"Iright","version":"1.0","type":"link"}