{"product_id":"proteintech-25137-1-ap","title":"Proteintech, 25137-1-AP, ONECUT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ONECUT1 (25137-1-AP) by Proteintech is a Polyclonal antibody targeting ONECUT1 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n25137-1-AP targets ONECUT1 in WB, IHC, IF, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue\nPositive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nONECUT1, also named as Hepatocyte nuclear factor 6 (HNF6), is a 465 amino acid protein, which contains one CUT DNA-binding domain and one homeobox DNA-binding domain. ONECUT1 localizes in the nucleus and belongs to the CUT homeobox family. ONECUT1 as a transcription activator is involved in the some liver genes transcription. ONECUT1 is highly expressed in liver and lower in testis, skin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18250 Product name: Recombinant human ONECUT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 167-292 aa of BC140830 Sequence: PYHKDVAGMGQSLSPLSSSGLGSIHNSQQGLPHYAHPGAAMPTDKMLTPNGFEAHHPAMLGRHGEQHLTPTSAGMVPINGLPPHHPHAHLNAQGHGQLLGTAREPNPSVTGAQVSNGSNSGQMEEI Predict reactive species\nFull Name: one cut homeobox 1\nCalculated Molecular Weight: 465 aa, 51 kDa\nObserved Molecular Weight: 51-55 kDa\nGenBank Accession Number: BC140830\nGene Symbol: ONECUT1\nGene ID (NCBI): 3175\nRRID: AB_2879918\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBC0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868985741481,"sku":"25137-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25137-1-ap","provider":"Iright","version":"1.0","type":"link"}