{"product_id":"proteintech-25146-1-ap","title":"Proteintech, 25146-1-AP, Cathepsin E Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cathepsin E (25146-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin E in WB, ELISA applications with reactivity to human, mouse, rat samples\n25146-1-AP targets Cathepsin E in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Calu-3 cells, mouse stomach tissue,  rat stomach tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCathepsin E (CTSE) is an aspartic protease and a member of the peptidase A1 family of proteases, along with pepsin A and cathepsin D (CTSD) (PMID: 31582345). Caathepsin E is essential for degradation of these lysosomal membrane proteins, and that its deficiency is implicated in the development of a new form of lysosomal storage disorder associated with the elevation of lysosomal pH (PMID: 17095504). It associates with lysosomal and endosomal pathways participating actively in immune response regulation. Cathepsin E specifically induces growth arrest and apoptosis in human prostate cancer cell lines (PMID: 20482316).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18484 Product name: Recombinant human CTSE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 108-275 aa of BC042537 Sequence: YCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEG Predict reactive species\nFull Name: cathepsin E\nCalculated Molecular Weight: 396 aa, 43 kDa\nObserved Molecular Weight: 43-48 kDa\nGenBank Accession Number: BC042537\nGene Symbol: CTSE\nGene ID (NCBI): 1510\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14091\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885841502377,"sku":"25146-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25146-1-ap","provider":"Iright","version":"1.0","type":"link"}