{"product_id":"proteintech-25151-1-ap","title":"Proteintech, 25151-1-AP, Syncoilin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Syncoilin (25151-1-AP) by Proteintech is a Polyclonal antibody targeting Syncoilin in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n25151-1-AP targets Syncoilin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: mouse heart tissue, human heart tissue,  mouse skeletal muscle tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSyncoilin also known as SYNC1, is a member of the intermediate filament family with an N-terminal head domain, followed by a central coiled-coil region and a short C-terminal tail. Syncoilin is highly expressed in skeletal and cardiac muscle. In normal skeletal muscle, syncoilin is concentrated at the neuromuscular junction(PMID: 11053421). Western blot analysis detected 64 kDa and 55 kDa syncoilin proteins in mouse heart(PMID: 11053421).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18565 Product name: Recombinant human SYNC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 332-482 aa of BC119700 Sequence: MAESRQDLEEEYEPQFLRLLERKEAGTKALQRTQAEIQEMKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEERQRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKAMLLPKSLEQADAPTSQAGGMETQSQGAV Predict reactive species\nFull Name: syncoilin, intermediate filament protein\nCalculated Molecular Weight: 482 aa, 55 kDa\nObserved Molecular Weight: 64-68 kDa, 55 kDa\nGenBank Accession Number: BC119700\nGene Symbol: SYNC\nGene ID (NCBI): 81493\nRRID: AB_2879926\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H7C4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869774500009,"sku":"25151-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25151-1-ap","provider":"Iright","version":"1.0","type":"link"}