{"product_id":"proteintech-25162-1-ap","title":"Proteintech, 25162-1-AP, DNAJC18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAJC18 (25162-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC18 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n25162-1-AP targets DNAJC18 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A431 cells,  HepG2 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDnaJC18, also named as DnaJ (Hsp40) homolog, subfamily C, member 21, belongs to Type III DnaJ Family. Type III DnaJ proteins have a J domain but lack the other sequence features that are found in type I and II members of the family. DnaJC18 might play a role in the process of spermatogenesis in adult testis (PMID: 29082339).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18498 Product name: Recombinant human DNAJC18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 196-358 aa of BC030162 Sequence: TDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSAFIQLLPVLVIVIISVITQLLATNPPYSLFYKSTLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKLIGLRRGG Predict reactive species\nFull Name: DnaJ (Hsp40) homolog, subfamily C, member 18\nCalculated Molecular Weight: 358 aa, 42 kDa\nObserved Molecular Weight: 39-42 kDa\nGenBank Accession Number: BC030162\nGene Symbol: DNAJC18\nGene ID (NCBI): 202052\nRRID: AB_2918087\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H819\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887248330921,"sku":"25162-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25162-1-ap","provider":"Iright","version":"1.0","type":"link"}