{"product_id":"proteintech-25197-1-ap","title":"Proteintech, 25197-1-AP, COA1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COA1 (25197-1-AP) by Proteintech is a Polyclonal antibody targeting COA1 in IF\/ICC, ELISA applications with reactivity to human samples\n25197-1-AP targets COA1 in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOA1, also named as C7orf44 and MITRAC15, is a mitochondrial translation regulation assembly intermediate of cytochrome c oxidase protein with MW 15 kDa. It's a component of some MITRAC complex, a cytochrome c oxidase (COX) assembly intermediate complex that regulates COX assembly. COA1 is required for assembly of mitochondrial respiratory chain complex I and complex IV.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18313 Product name: Recombinant human C7orf44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC056884 Sequence: MMWQKYAGSRRSMPLGARILFHGVFYAGGFAIVYYLIQKFHSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE Predict reactive species\nFull Name: Cytochrome c oxidase assembly factor 1 homolog\nCalculated Molecular Weight: 146 aa, 17 kDa\nGenBank Accession Number: BC056884\nGene Symbol: COA1\nGene ID (NCBI): 55744\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZY4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886710149289,"sku":"25197-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25197-1-ap","provider":"Iright","version":"1.0","type":"link"}