{"product_id":"proteintech-25206-1-ap","title":"Proteintech, 25206-1-AP, DAAM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DAAM2 (25206-1-AP) by Proteintech is a Polyclonal antibody targeting DAAM2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n25206-1-AP targets DAAM2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  rat brain tissue,  Transfected HEK-293 cells\nPositive IHC detected in: mouse heart tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18955 Product name: Recombinant human DAAM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-55 aa of BC128388 Sequence: RKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAEL Predict reactive species\nFull Name: dishevelled associated activator of morphogenesis 2\nCalculated Molecular Weight: 1068 aa, 123 kDa\nObserved Molecular Weight: 100-130 kDa\nGenBank Accession Number: BC128388\nGene Symbol: DAAM2\nGene ID (NCBI): 23500\nRRID: AB_2879959\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q86T65\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869402484905,"sku":"25206-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25206-1-ap","provider":"Iright","version":"1.0","type":"link"}