{"product_id":"proteintech-25251-1-ap","title":"Proteintech, 25251-1-AP, OPN5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OPN5 (25251-1-AP) by Proteintech is a Polyclonal antibody targeting OPN5 in IF-P, ELISA applications with reactivity to human, mouse samples\n25251-1-AP targets OPN5 in IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF-P detected in: mouse eye tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuropsin (OPN5) is an opsin family member known as a photopigment responsive to wavelengths in the near-UV (λmax = 380 nm) (PMID: 31607531).  In mammals, OPN5 is required to photoentrainment the local circadian oscillator in the murine retina and cornea (PMID: 21135214).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19384 Product name: Recombinant human OPN5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 263-354 aa of BC126198 Sequence: IAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEWE Predict reactive species\nFull Name: opsin 5\nCalculated Molecular Weight: 354 aa, 40 kDa\nGenBank Accession Number: BC126198\nGene Symbol: OPN5\nGene ID (NCBI): 221391\nRRID: AB_3669465\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6U736\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887746273449,"sku":"25251-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25251-1-ap","provider":"Iright","version":"1.0","type":"link"}