{"product_id":"proteintech-25257-1-ap","title":"Proteintech, 25257-1-AP, MYBPC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYBPC2 (25257-1-AP) by Proteintech is a Polyclonal antibody targeting MYBPC2 in WB, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n25257-1-AP targets MYBPC2 in WB, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue\nPositive IP detected in: mouse skeletal muscle tissue\nPositive IF-P detected in: mouse skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYBPC2, also known as MYBPCF, fMyBP-C, is a member of the myosin-binding protein C (MYBPC)family. MYBPC is a myosin-associated protein found in the cross-bridge-bearing zone, or C region, of A bands in striated muscle. MYBPC has three paralogs encoded by unique genes, including slow skeletal (MYBPC1), fast skeletal (MYBPC2), and cardiac (MYBPC3). Slow skeletal MyBP-C (sMyBP-C), fast skeletal MyBP-C (fMyBP-C), and cardiac MyBP-C (cMyBP-C) proteins are highly conserved with over 90% homology. They play unique muscle-specific structural and regulatory roles in actomyosin interactions and contractility in striated muscles, including both cardiac and skeletal muscles (PMID: 35832193, 23936073).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19424 Product name: Recombinant human MYBPC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-227 aa of BC136389 Sequence: MPEAKPAAKKAPKGKDAPKGAPKEAPPKEAPAEAPKEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTSEKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYE Predict reactive species\nFull Name: myosin binding protein C, fast type\nCalculated Molecular Weight: 1141 aa, 128 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC136389\nGene Symbol: MYBPC2\nGene ID (NCBI): 4606\nRRID: AB_3669466\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14324\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887729922217,"sku":"25257-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25257-1-ap","provider":"Iright","version":"1.0","type":"link"}