{"product_id":"proteintech-25285-1-ap","title":"Proteintech, 25285-1-AP, CCL25\/TECK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCL25\/TECK (25285-1-AP) by Proteintech is a Polyclonal antibody targeting CCL25\/TECK in IHC, ELISA applications with reactivity to human samples\n25285-1-AP targets CCL25\/TECK in IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human thymus tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL25, also known as Thymus-Expressed Chemokine (TECK), is a small chemokine belonging to the CC subfamily, first isolated from mouse thymus in 1997. Its official full name is \"C-C motif chemokine ligand 25\". CCL25 is mainly expressed in the thymus and small-intestinal epithelium, and to a lesser extent by vascular endothelial cells and other parenchymal tissues. It selectively attracts dendritic cells, thymocytes, and activated macrophages via binding to its high-affinity G-protein-coupled receptor CCR9, while showing no chemotactic activity on peripheral blood lymphocytes or neutrophils. Through this CCR9-CCL25 axis it orchestrates T-cell development in the thymus and guides CCR9⁺ lymphocytes-especially IgA-producing plasma cells and intra-epithelial lymphocytes-to the small intestine, thus participating in mucosal immunity and gut homeostasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17994 Product name: Recombinant human CCL25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-150 aa of BC130561 Sequence: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL Predict reactive species\nFull Name: chemokine (C-C motif) ligand 25\nCalculated Molecular Weight: 150 aa, 17 kDa\nGenBank Accession Number: BC130561\nGene Symbol: CCL25\/TECK\nGene ID (NCBI): 6370\nRRID: AB_2880008\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15444\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869651947689,"sku":"25285-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25285-1-ap","provider":"Iright","version":"1.0","type":"link"}