{"product_id":"proteintech-25296-1-ap","title":"Proteintech, 25296-1-AP, Claudin 23 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Claudin 23 (25296-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 23 in WB, IHC, ELISA applications with reactivity to human samples\n25296-1-AP targets Claudin 23 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nClaudin 23 (CLDN23) belongs to the large claudin family of proteins, which are tetraspan transmembrane proteins of tight junctions (PMID: 12736707; 18036336). Claudins exhibit specific patterns of expression in different tissues. Human CLDN23 mRNA was expressed in germinal center B cells, placenta, stomach as well as in colon tumor (PMID: 12736707). CLDN23 has been reported as a candidate tumor suppressor gene implicated in intestinal-type gastric cancer (PMID: 12736707).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18189 Product name: Recombinant human CLDN23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-292 aa of BC125148 Sequence: WCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL Predict reactive species\nFull Name: claudin 23\nCalculated Molecular Weight: 292 aa, 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC125148\nGene Symbol: Claudin 23\nGene ID (NCBI): 137075\nRRID: AB_2880013\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96B33\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869525233833,"sku":"25296-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25296-1-ap","provider":"Iright","version":"1.0","type":"link"}