{"product_id":"proteintech-25315-1-ap","title":"Proteintech, 25315-1-AP, RUNX1 (middle) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RUNX1 (middle) (25315-1-AP) by Proteintech is a Polyclonal antibody targeting RUNX1 (middle) in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n25315-1-AP targets RUNX1 (middle) in WB, IF\/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue, Jurkat cells,  Rat thymus tissue\nPositive IP detected in: Jurkat cells\nPositive IF\/ICC detected in: U-251 cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRunt-related transcription factor 1 (RUNX1), also named AML1 or CBF alpha 2, is a 453 amino acid protein, which contains one Runt domain. RUNX1 localizes in the nucleus and is expressed in all tissues except the brain and heart. RUNX1 is involved in hematopoiesis and is frequently targeted in human leukemia by chromosomal translocations that fuse the DNA-binding domain of RUNX1 to other transcription factors and corepressor molecules. In addition to its role in leukemogenesis, RUNX1 is also involved in sensory neuron diversification. RUNX1 exists in some isoforms with a range of MV 20-52 kDa. The calculated molecular weight of isoform 1 is 49 kDa, but the modified protein is about 49-55 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag17838 Product name: Recombinant human RUNX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 214-277 aa of BC136381 Sequence: TKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSP Predict reactive species\nFull Name: runt-related transcription factor 1\nCalculated Molecular Weight: 480 aa, 52 kDa\nObserved Molecular Weight: 48-55 kDa\nGenBank Accession Number: BC136381\nGene Symbol: RUNX1\nGene ID (NCBI): 861\nRRID: AB_2880026\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01196\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868849852585,"sku":"25315-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25315-1-ap","provider":"Iright","version":"1.0","type":"link"}