{"product_id":"proteintech-25320-1-ap","title":"Proteintech, 25320-1-AP, EHD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EHD3 (25320-1-AP) by Proteintech is a Polyclonal antibody targeting EHD3 in WB, IHC, ELISA applications with reactivity to human,  mouse, rat samples\n25320-1-AP targets EHD3 in WB, IF, IHC, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human peripheral blood platelets,  rat brain tissue,  mouse kidney tissue\nPositive IHC detected in: mouse lung tissue, human brain tissue,  mouse brain tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18216 Product name: Recombinant human EHD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 353-422 aa of BC156996 Sequence: FPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPIQMVKGGAFEGTLHGPF Predict reactive species\nFull Name: EH-domain containing 3\nCalculated Molecular Weight: 535 aa, 61 kDa\nObserved Molecular Weight: 61 kDa\nGenBank Accession Number: BC156996\nGene Symbol: EHD3\nGene ID (NCBI): 30845\nRRID: AB_2880029\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NZN3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868979843241,"sku":"25320-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25320-1-ap","provider":"Iright","version":"1.0","type":"link"}