{"product_id":"proteintech-25323-1-ap","title":"Proteintech, 25323-1-AP, CD32A\/C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD32A\/C (25323-1-AP) by Proteintech is a Polyclonal antibody targeting CD32A\/C in WB, ELISA applications with reactivity to human samples\n25323-1-AP targets CD32A\/C in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, U-937 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIgG Fc receptors (FcγRs) play important roles in immune responses. The low-affinity IgG Fc receptor, FcγRII (CD32), consists of a family of primarily cell membrane receptor proteins: CD32A, CD32B, and CD32C. They are encoded by the mRNA splice variants of three highly related genes: FCGR2A, FCGR2B, and FCGR2C (PMID: 30941127). CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. This antibody raised against 254-323 aa of human CD32C (FCGR2C) can recognize both CD32A and CD32C forms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag18123 Product name: Recombinant human FCGR2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 254-323 aa of BC137397 Sequence: ANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN Predict reactive species\nFull Name: Fc fragment of IgG, low affinity IIc, receptor for (CD32)\nCalculated Molecular Weight: 323 aa, 36 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC137397\nGene Symbol: CD32A\/C\nGene ID (NCBI): 9103\nRRID: AB_3085785\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31995\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886229049513,"sku":"25323-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25323-1-ap","provider":"Iright","version":"1.0","type":"link"}