{"product_id":"proteintech-25348-1-ap","title":"Proteintech, 25348-1-AP, RSPO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RSPO1 (25348-1-AP) by Proteintech is a Polyclonal antibody targeting RSPO1 in WB, IHC, ELISA applications with reactivity to human, rat samples\n25348-1-AP targets RSPO1 in WB, IF, IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, rat plasma\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRSPO1, also named R-spondin-1, Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential role in ovary determination. Regulates Wnt signaling by antagonizing DKK1\/KREM1-mediated internalization of LRP6 through an interaction with KREM1. RSPO1 seems to mainly localize to nucleoli (PMID:17804805).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21858 Product name: Recombinant human RSPO1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-263 aa of BC114966 Sequence: MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA Predict reactive species\nFull Name: R-spondin homolog (Xenopus laevis)\nCalculated Molecular Weight: 263 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC114966\nGene Symbol: RSPO1\nGene ID (NCBI): 284654\nRRID: AB_2880038\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q2MKA7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869009694889,"sku":"25348-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25348-1-ap","provider":"Iright","version":"1.0","type":"link"}