{"product_id":"proteintech-25357-1-ap","title":"Proteintech, 25357-1-AP, PPP1R16B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP1R16B (25357-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R16B in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n25357-1-AP targets PPP1R16B in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPP1R16B (Protein Phosphatase 1 Regulatory Subunit 16B), also known as TIMAP or ANKRD4, is a membrane-associated protein that acts as a regulator of protein phosphatase 1 (PP1). It contains five ankyrin repeats, a PP1-interacting domain, and a C-terminal CAAX box domain. The synthesis of PPP1R16B is inhibited by transforming growth factor-beta-1 (TGF-β-1), and it is predominantly expressed in endothelial cells. It has 2 isoforms with the molecular mass of 59 and 64 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19269 Product name: Recombinant human PPP1R16B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 351-565 aa of BC131801 Sequence: LSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKIPRGELDMPVENGLRAPVSAYQYALANGDVWKVHEVPDYSMAYGNPGVADATPPWSSYKEQSPQTLLELKRQRAAAKLLSHPFLSTHLGSSMARTGESSSEGKAPLIGGRTSPYSSNGTSVYYTVTSGDPPLLKFKAPIEEMEEKVHGCCR Predict reactive species\nFull Name: protein phosphatase 1, regulatory (inhibitor) subunit 16B\nCalculated Molecular Weight: 567 aa, 64 kDa\nObserved Molecular Weight: 60 kDa, 70 kDa\nGenBank Accession Number: BC131801\nGene Symbol: PPP1R16B\nGene ID (NCBI): 26051\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96T49\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887770128553,"sku":"25357-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25357-1-ap","provider":"Iright","version":"1.0","type":"link"}