{"product_id":"proteintech-25358-1-ap","title":"Proteintech, 25358-1-AP, MRP3\/ABCC3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRP3\/ABCC3 (25358-1-AP) by Proteintech is a Polyclonal antibody targeting MRP3\/ABCC3 in WB, IHC, ELISA applications with reactivity to human samples\n25358-1-AP targets MRP3\/ABCC3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 37°C incubated HeLa cells\nPositive IHC detected in: human colon tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMRP3 also known as ABCC3, belongs to ATP-binding cassette (ABC) transporter protein superfamily. MRP3 hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants, and endogenous compounds across cell membranes (PMID: 11581266, 15083066). In normal liver, MRP3 was found present mainly in the bile ducts. In livers of patients with various forms of cholestasis, MRP3 levels were frequently increased in the proliferative cholangiocytes, suggesting its role in cholehepatic and enterohepatic bile circulation and in protecting liver from toxic bile salts( PMID: 11850532, 11283840). MRP3 is expressed in the liver, colon, pancreas, and, at a lower level, in the kidney (PMID:10094960). For optimal WB detection of this membrane protein, we recommend to avoid boiling the sample after lysis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag19786 Product name: Recombinant human ABCC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 838-960 aa of BC137348 Sequence: LLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW Predict reactive species\nFull Name: ATP-binding cassette, sub-family C (CFTR\/MRP), member 3\nCalculated Molecular Weight: 1527 aa, 169 kDa\nObserved Molecular Weight: 170-180 kDa\nGenBank Accession Number: BC137348\nGene Symbol: MRP3\nGene ID (NCBI): 8714\nRRID: AB_3085789\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15438\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869712142505,"sku":"25358-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25358-1-ap","provider":"Iright","version":"1.0","type":"link"}