{"product_id":"proteintech-25395-1-ap","title":"Proteintech, 25395-1-AP, FAM20C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM20C (25395-1-AP) by Proteintech is a Polyclonal antibody targeting FAM20C in IHC, ELISA applications with reactivity to human, mouse, rat samples\n25395-1-AP targets FAM20C in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human kidney tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM20C, also named as Golgi-enriched fraction casein kinase or Dentin matrix protein 4, is a 584 amino acid protein, which belongs to the FAM20 family. FAM20C is widely expressed.  FAM20C as a Calcium-binding kinase that phosphorylates the caseins and several secreted proteins implicated in biomineralization, including the secretory calcium binding phosphoproteins (SCPP).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22061 Product name: Recombinant human FAM20C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 121-269 aa of BC040074 Sequence: AHRPLLRDPGPRRSESPPGPGGDASLLARLFEHPLYRVAVPPLTEEDVLFNVNSDTRLSPKAAENPDWPHAGAEGAEFLSPGEAAVDSYPNWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSGGTQLKLIMTFQNYGQAL Predict reactive species\nFull Name: family with sequence similarity 20, member C\nCalculated Molecular Weight: 584 aa, 66 kDa\nGenBank Accession Number: BC040074\nGene Symbol: FAM20C\nGene ID (NCBI): 56975\nRRID: AB_2880058\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IXL6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868965851305,"sku":"25395-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25395-1-ap","provider":"Iright","version":"1.0","type":"link"}