{"product_id":"proteintech-25399-1-ap","title":"Proteintech, 25399-1-AP, FOXN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FOXN3 (25399-1-AP) by Proteintech is a Polyclonal antibody targeting FOXN3 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n25399-1-AP targets FOXN3 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  mouse embryo tissue\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAs transcriptional regulators, the FOX protein family regulates the development of tissues, embryos as well as carbohydrate and lipid metabolism. Forkhead box N3 (FOXN3), also known as checkpoint suppressor 1 (CHES1), is initially identified from yeast and belongs to the FOX protein family as it contains a conserved FOX DNA binding domain in its N-terminal(PMID: 36450706). FOXN3 had been dysregulated in many types of malignancies including melanoma, osteosarcoma, hepatocellular carcinoma and breast cancer, and its expression level is strongly associated with progression and prognosis of patients(PMID: 31214487).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21929 Product name: Recombinant human FOXN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC007506 Sequence: MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEEL Predict reactive species\nFull Name: forkhead box N3\nCalculated Molecular Weight: 490 aa, 54 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC007506\nGene Symbol: FOXN3\nGene ID (NCBI): 1112\nRRID: AB_3085795\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00409\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869685076137,"sku":"25399-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25399-1-ap","provider":"Iright","version":"1.0","type":"link"}