{"product_id":"proteintech-25411-1-ap","title":"Proteintech, 25411-1-AP, ZNF740 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF740 (25411-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF740 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n25411-1-AP targets ZNF740 in WB, IHC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse testis tissue,  PC-3 cells,  mouse liver tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22295 Product name: Recombinant human ZNF740 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC053557 Sequence: MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDDDSLSEASHSKKTVKKVVVVEQN Predict reactive species\nFull Name: zinc finger protein 740\nCalculated Molecular Weight: 193 aa, 22 kDa\nObserved Molecular Weight: 22-30 kDa\nGenBank Accession Number: BC053557\nGene Symbol: ZNF740\nGene ID (NCBI): 283337\nRRID: AB_2880065\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NDX6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869629010089,"sku":"25411-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25411-1-ap","provider":"Iright","version":"1.0","type":"link"}