{"product_id":"proteintech-25444-1-ap","title":"Proteintech, 25444-1-AP, DNAJC9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNAJC9 (25444-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC9 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n25444-1-AP targets DNAJC9 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, SH-SY5Y cells,  Raji cells,  HeLa cells\nPositive IHC detected in: human breast cancer tissue, human colon cancer tissue,  mouse colon tissue,  rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNAJC9, DnaJ homolog subfamily C member 9, acts as a dual histone chaperone and heat shock co-chaperone (PMID: 33857403). As a histone chaperone, DNAJC9 forms a co-chaperone complex with MCM2 and histone H3-H4 heterodimers (PMID: 33857403). DNAJC9 also plays a role as co-chaperone of the HSP70 family of molecular chaperone proteins. (PMID: 17182002, PMID: 33857403). DNAJC9 exhibits activity to assemble histones onto DNA (PMID: 33857403). DNAJC9 is an essential protein in many cancer cell types and the levels of the protein correlate with the rates at which cancer cells proliferate.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22123 Product name: Recombinant human DNAJC9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-260 aa of BC136507 Sequence: MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK Predict reactive species\nFull Name: DnaJ (Hsp40) homolog, subfamily C, member 9\nCalculated Molecular Weight: 260 aa, 30 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC136507\nGene Symbol: DNAJC9\nGene ID (NCBI): 23234\nRRID: AB_2880084\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WXX5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869403566249,"sku":"25444-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25444-1-ap","provider":"Iright","version":"1.0","type":"link"}