{"product_id":"proteintech-25471-1-ap","title":"Proteintech, 25471-1-AP, STK10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STK10 (25471-1-AP) by Proteintech is a Polyclonal antibody targeting STK10 in WB, IHC, ELISA applications with reactivity to human samples\n25471-1-AP targets STK10 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SKOV-3 cells,  A549 cells,  COLO 320 cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLymphocyte-oriented kinase deficiency encoded by the serine\/threonine kinase 10 (STK10) gene correlates with the intracellular adhesion molecule 1 (ICAM-1)\/lymphocyte function associated antigen 1 (LFA-1) complex in aspirin hypersensitivity(PMID:21905501). STK 10 is also named as LOK and expressed\nas a 130-kDa protein, which was detected predominantly in lymphoid organs such as spleen, thymus, and bone marrow, in contrast to other mammalian members of the STE20 family(PMID:9278426).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22169 Product name: Recombinant human STK10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 369-519 aa of BC070077 Sequence: SQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDARIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGPSKRDSDCSSLCTSESMDYGTNLSTDLSLNKEMGSLSIKD Predict reactive species\nFull Name: serine\/threonine kinase 10\nCalculated Molecular Weight: 968 aa, 112 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC070077\nGene Symbol: STK10\nGene ID (NCBI): 6793\nRRID: AB_2880096\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O94804\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869609185449,"sku":"25471-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25471-1-ap","provider":"Iright","version":"1.0","type":"link"}