{"product_id":"proteintech-25487-1-ap","title":"Proteintech, 25487-1-AP, GRAMD1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRAMD1A (25487-1-AP) by Proteintech is a Polyclonal antibody targeting GRAMD1A in WB, IHC, ELISA applications with reactivity to human samples\n25487-1-AP targets GRAMD1A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293T cells,  HeLa cells,  SH-SY5Y cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProtein Aster-A (GRAMD1A) is a cholesterol transporter, which contains unique domains for binding cholesterol and the plasma membrane (PM), thereby serving as a molecular bridge for the transfer of cholesterol from the PM to the endoplasmic reticulum (ER). It was reported that plays a role in autophagy regulation and is required for the biogenesis of the autophagosome (PMID:31222192). It can be detected as 80 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22221 Product name: Recombinant human GRAMD1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 234-465 aa of BC014077 Sequence: LQLNGLGTPKEVGDVIALSDITSSGAADRSQEPSPVGSRRGHVTPNLSRASSDADHGAEEDKEEQVDSQPDASSSQTVTPVAEPPSTEPTQPDGPTTLGPLDLLPSEELLTDTSNSSSSTGEEADLAALLPDLSGRLLINSVFHVGAERLQQMLFSDSPFLQGFLQQCKFTDVTLSPWSGDSKCHQRRVLTYTIPISNPLGPKSASVVETQTLFRRGPQAGGCVVDSEVLTQ Predict reactive species\nFull Name: GRAM domain containing 1A\nCalculated Molecular Weight: 724 aa, 81 kDa\nObserved Molecular Weight: 80-90 kDa\nGenBank Accession Number: BC014077\nGene Symbol: GRAMD1A\nGene ID (NCBI): 57655\nRRID: AB_2935462\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CP6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887658881193,"sku":"25487-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25487-1-ap","provider":"Iright","version":"1.0","type":"link"}