{"product_id":"proteintech-25490-1-ap","title":"Proteintech, 25490-1-AP, MOSC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MOSC1 (25490-1-AP) by Proteintech is a Polyclonal antibody targeting MOSC1 in WB, ELISA applications with reactivity to human, mouse samples\n25490-1-AP targets MOSC1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMOSC1 also known as MTARC1 and MARC1. It has 3 isoforms and is mainly expressed in liver, breast and adipose tissue. It is a novel signal-anchored protein of the outer mitochondrial membrane and is active in the N- reductive enzyme system and was also found to contribute to the regulation of nitric oxide synthesis (PMID: 23086957).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21989 Product name: Recombinant human MOSC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-230 aa of BC010619 Sequence: LTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEAAAQWITSFLKSQPYRLVHFEPHKRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEK Predict reactive species\nFull Name: MOCO sulphurase C-terminal domain containing 1\nCalculated Molecular Weight: 337 aa, 37 kDa\nObserved Molecular Weight: 35-42 kDa\nGenBank Accession Number: BC010619\nGene Symbol: MOSC1\nGene ID (NCBI): 64757\nRRID: AB_3669480\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5VT66\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887722549417,"sku":"25490-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25490-1-ap","provider":"Iright","version":"1.0","type":"link"}