{"product_id":"proteintech-25500-1-ap","title":"Proteintech, 25500-1-AP, MATN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MATN3 (25500-1-AP) by Proteintech is a Polyclonal antibody targeting MATN3 in WB, IHC, ELISA applications with reactivity to human samples\n25500-1-AP targets MATN3 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human milk\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMatrilin-3 is a protein that in humans is encoded by the MATN3 gene. It is linked to the development of many types of cartilage, and part of the Matrilin family, which includes Matrilin-1, Matrilin-2, Matrilin-3, and Matrilin-4, a family of filamentous-forming adapter oligomeric extracellular proteins that are linked to the formation of cartilage and bone, as well as maintaining homeostasis after development. It is considered an extracellular matrix protein that functions as an adapter protein where the Matrilin-3 subunit can form both homo-tetramers and hetero-oligomers with subunits from Matrilin-1 which is the cartilage matrix protein. This restricted tissue has been strongly expressed in growing skeletal tissue as well as cartilage and bone.( PMID:26499313, 27104523, 11950247)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21932 Product name: Recombinant human MATN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 256-384 aa of BC139907 Sequence: SRFQETFCALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHHCECYEGYTLNAD Predict reactive species\nFull Name: matrilin 3\nCalculated Molecular Weight: 486 aa, 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC139907\nGene Symbol: MATN3\nGene ID (NCBI): 4148\nRRID: AB_3085799\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15232\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887714193577,"sku":"25500-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25500-1-ap","provider":"Iright","version":"1.0","type":"link"}