{"product_id":"proteintech-25513-1-ap","title":"Proteintech, 25513-1-AP, MPZL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MPZL3 (25513-1-AP) by Proteintech is a Polyclonal antibody targeting MPZL3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n25513-1-AP targets MPZL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse brain tissue,  rat liver tissue,  mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMPZL3 (Myelin protein zero-like protein 3) is a member of the myelin P0 protein family. The human MPZL3 gene is located at chromosome 11q23.3, and encodes a 235-amino acid polypeptide with an Immunoglobulin V-type (IgV) domain. MPZL3 protein is a membrane adhesion protein. It may be involved in immune function (PMID: 19054061). This polyclonal antibody raised against 32-235aa of human MPZL3 reveals bands of 28 kDa and 70 kDa, which could be endogenous MPZL3 of unmodified form and post-translational modified form, respectively (PMID: 17273165).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag21905 Product name: Recombinant human MPZL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 32-235 aa of BC113586 Sequence: LEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY Predict reactive species\nFull Name: myelin protein zero-like 3\nCalculated Molecular Weight: 235 aa, 26 kDa\nObserved Molecular Weight: 70 kDa, 28 kDa\nGenBank Accession Number: BC113586\nGene Symbol: MPZL3\nGene ID (NCBI): 196264\nRRID: AB_2880111\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UWV2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869711945897,"sku":"25513-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25513-1-ap","provider":"Iright","version":"1.0","type":"link"}