{"product_id":"proteintech-25526-1-ap","title":"Proteintech, 25526-1-AP, SLC35F2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC35F2 (25526-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35F2 in WB, ELISA applications with reactivity to human,  mouse samples\n25526-1-AP targets SLC35F2 in WB, IP, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC35F2, also named as Solute carrier family 35 member F2, is a 374 amino acid protein, which belongs to the SLC35F solute transporter family. SLC35F2 as a Multi-pass membrane protein is a putative solute transporter. SLC35F2 is highly homologous to the lung squamous cell cancer-related gene, LSCC3, which is highly expressed in lung squamous cell tumour tissues. However, the clinical implication of the SLC35F2 gene in tumour development and progression remains unclear.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag20901 Product name: Recombinant human SLC35F2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-132 aa of BC039195 Sequence: MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQSFINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYT Predict reactive species\nFull Name: solute carrier family 35, member F2\nCalculated Molecular Weight: 374 aa, 41 kDa\nObserved Molecular Weight: 41-50 kDa\nGenBank Accession Number: BC039195\nGene Symbol: SLC35F2\nGene ID (NCBI): 54733\nRRID: AB_2880119\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IXU6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869384921257,"sku":"25526-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25526-1-ap","provider":"Iright","version":"1.0","type":"link"}