{"product_id":"proteintech-25589-1-ap","title":"Proteintech, 25589-1-AP, SMCHD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMCHD1 (25589-1-AP) by Proteintech is a Polyclonal antibody targeting SMCHD1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n25589-1-AP targets SMCHD1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nStructural maintenance of chromosomes flexible hinge domain containing 1 (SMCHD1) is considered a non-canonical member of the SMC family owing to differences in its type of ATPase domain and in its overall linear domain architecture (PMID: 32779700). SMCHD1 is best known for its role in promoting DNA methylation and gene silencing, with apparent roles in X chromosome inactivation, imprinted gene regulation, and autosome gene cluster repression (PMID: 31668908). Variations in the SMCHD1 gene are associated with two debilitating human disorders, facioscapulohumeral muscular dystrophy (FSHD) and Bosma arhinia microphthalmia syndrome (BAMS)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag22293 Product name: Recombinant human SMCHD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1813-2005 aa of BC035774 Sequence: LLTFPDNVEHCETVFGMLLGDTIILDNLDAANHYRKEVVKITHCPTLLTRDGDRIRSNGKFGGLQNKAPPMDKLRGMVFGAPVPKQCLILGEQIDLLQQYRSAVCKLDSVNKDLNSQLEYLRTPDMRKKKQELDEHEKNLKLIEEKLGMTPIRKCNDSLRHSPKVETTDCPVPPKRMRREATRQNRIITKTDV Predict reactive species\nFull Name: structural maintenance of chromosomes flexible hinge domain containing 1\nCalculated Molecular Weight: 2005 aa, 226 kDa\nObserved Molecular Weight: 220 kDa\nGenBank Accession Number: BC035774\nGene Symbol: SMCHD1\nGene ID (NCBI): 23347\nRRID: AB_2880144\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A6NHR9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869767979177,"sku":"25589-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-25589-1-ap","provider":"Iright","version":"1.0","type":"link"}